Public Data Portal - Specimen Record

 
 
 
 
 
Specimen Data Sequences Combined
  Record Details For SDP100008-13     Back to Search: Records
  IDENTIFIERS:
  Sample ID: U13LK02 Museum ID:
  Field ID: U13LK02 Collection Code:
  Deposited In: University of California, San Diego
 

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  TAXONOMY:
  Phylum: Arthropoda Subfamily:
  Class: Malacostraca Genus: Excirolana
  Order: Isopoda Species: Excirolana chiltoni
  Family: Cirolanidae Subspecies:
  BIN (Cluster ID): BOLD:ACM2480
  * Barcode Index Numbers(BIN): cluster barcode sequences to create OTUs that closely reflect species groupings
  SPECIMEN DETAILS:
  Voucher Status: Vouchered:Registered Collection Reproduction:
  Tissue Descriptor: Sex:
  Brief Note: Life Stage:
  Detailed Notes: ::meta:{"specimen":["Lauren Kitayama"],"image":["Lauren Kitayama"],"trace_run_site":["Generic Commercial Lab"],"trace_upload":["Lauren Kitayama"],"sequencing_run_site":["Generic Commercial Lab"],"sequence_upload":["Lauren Kitayama"]}::endMeta:
 
  COLLECTION DATA:
  Country: United States Date Collected: 2013-08-01
  Province/State: California Collectors: Lauren Kitayama
  Region/County:    
  Sector:    
  Exact Site: UCSD Scripps Coastal Reserve Beach    
  Latitude: 32.8664 Elevation:
  Longitude: -117.254 Elv. Accuracy:
  Coord. Source: Depth:
  Coord. Accuracy: Depth Accuracy :
 
 

  SEQUENCE: COI-5P   [Funding Source: N/A]
  Sequence ID: SDP100008-13.COI-5P GenBank Accession: KP845265
  Last Updated: 2019-10-13 Genome: Mitochondrial
  Locus: Cytochrome Oxidase Subunit 1 5' Region
  Nucleotides: 602 bp
 
GACACTTTATTTTATTTTTGGGGCTTGGGCTGGGGCTGTAGGGACAGCTCTCAGGATAATTATCCGTACCGAGTT
GGGGCAACCTGGGAGATTTATTGGGGATGATCAGATTTATAATGTGGTGGTGACTGCCCACGCTTTCGTAATGAT
CTTCTTTTTGGTAATGCCGGTGATAATTGGAGGGTTTGGGAACTGGCTGGTCCCCCTGATGGTGGGGGCCCCTGA
TATGGCCTTTCCTCGGATAAACAATATAAGGTTTTGGCTACTACCCCCCGCTCTAACTTTGTTATTGGGGAGAGG
GTTGGTTGAGAGGGGGGTGGGGACGGGGTGAACGGTCTACCCCCCCTTATCTGCAGGGATTGCTCATAGGGGGGC
CTCTGTAGATCTGGGTATTTTTTCACTCCATTTAGCAGGGGCCTCTTCGATCTTAGGGGCTGTTAATTTTATCAC
TACGGTTATCAATATACGGGCTGGTGGTATCAGATATGATCGAACTCCCCTTTTTGTTTGATCCGTCTTTATCAC
GGCTATTCTGCTTCTGCTCTCTCTGCCCGTGCTTGCCGGGGCTATTACTATGCTACTTACCGACCGAAATTTAAA
TA
  Amino Acids:  
 
TLYFIFGAWAGAVGTALSMIIRTELGQPGSFIGDDQIYNVVVTAHAFVMIFFLVMPVMIGGFGNWLVPLMVGAPD
MAFPRMNNMSFWLLPPALTLLLGSGLVESGVGTGWTVYPPLSAGIAHSGASVDLGIFSLHLAGASSILGAVNFIT
TVINMRAGGISYDRTPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNLNX
  Illustrative Barcode:
 
   

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  ELECTROPHEROGRAM TRACE FILES: COI-5P
  Length Pcr Primers Seq Primer Read Status Run Date  
630 LCO1490 / HCO2198
HCO2198
Reverse high qual 2013-09-24  
634 LCO1490 / HCO2198
LCO1490
Forward high qual 2013-09-09  
 
Generated using the BOLD API

													
  Specimen Images:
  License:
CreativeCommons - Attribution Share-Alike (2013)
  License Holder:
Unspecified, University of California San Diego

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit
  License:
CreativeCommons - Attribution Share-Alike (2013)
  License Holder:
Unspecified, University of California San Diego

Comments

Add a Comment

No Comment made
More...

Tags

No tags
Edit

Collection Site:

  Attribution:
Specimen Depository: University of California, San Diego
Sequencing Center:
Photography: Lauren Kitayama, University of California San Diego
Collectors: Lauren Kitayama
Specimen Identification: Student
Project Manager: Student Portal Manager
Sequencing Support: